RBM10 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: RBM10 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB573578
• Supplier Catalog Number: orb573578
• Alternative Catalog Number: BYT-ORB573578-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10
• Conjugation: Unconjugated
• Alternative Names: S1-1, TARPS, GPATC9, ZRANB5, GPATCH9, DXS8237E

Product Description

Rabbit polyclonal antibody to RBM10

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 104 kDa
• NCBI: 005667
• UniProt: P98175
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
• Target: RBM10

Images

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is also present at 94 kDa. The protein is modified by phosphorylation.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Positive control (+): Mouse kidney (M-KI), Negative control (-): Rat liver (R-LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Epithelial cells of bronchiole, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

RBM10 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573578 with 1:200 dilution. Western blot was performed using orb573578 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: RBM10 IP with orb573578 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-RBM10 Antibody Titration: 1.4 ug/ml, ELISA Titer: 1:1562500, Positive Control: Daudi cell lysate, RBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.