Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Target:
TP53
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 44 kDa isoform is identified, and a second isoform of 34 kDa is also present in some samples. TP53 has > 12 isoforms, and this peptide is present in isoform 1, 2, 3, 6, and others.
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Immunohistochemistry with U20S/ PLKO cells tissue.
Immunohistochemistry with U20S/ PLKO cells tissue.
WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
* VAT and and shipping costs not included. Errors and price changes excepted