TP53 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TP53 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB573617
• Supplier Catalog Number: orb573617
• Alternative Catalog Number: BYT-ORB573617-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
• Conjugation: Unconjugated
• Alternative Names: P53, BCC7, LFS1, BMFS5, TRP53

Product Description

Rabbit polyclonal antibody to p53

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 44 kDa
• NCBI: 000537
• UniProt: P04637
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
• Target: TP53

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 44 kDa isoform is identified, and a second isoform of 34 kDa is also present in some samples. TP53 has > 12 isoforms, and this peptide is present in isoform 1, 2, 3, 6, and others.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with U20S/ PLKO cells tissue.

Immunohistochemistry with U20S/ PLKO cells tissue.

Rabbit Anti-TP53 Antibody, Catalog Number: orb573617, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: U20S/ PLKO cells.

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.