RIPK3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: RIPK3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB573829
• Supplier Catalog Number: orb573829
• Alternative Catalog Number: BYT-ORB573829-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3
• Conjugation: Unconjugated
• Alternative Names: RIP3

Product Description

Rabbit polyclonal antibody to RIPK3

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 57 kDa
• NCBI: 006862
• UniProt: Q9Y572
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
• Target: RIPK3

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: Lane 1: Transient overexpression lysate of RIPK3, Lane 2: Non-overexpressed vector control lysate, Antibody dilution: 1.0 ug/ml.

Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.

Human Heart

Human Liver

RIPK3 antibody - N-terminal region (orb573829), Catalog Number: orb573829, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas Tissue, Observed Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cells, Primary Antibody Concentration: 3 -12 ug/ml, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure: 0.2 seconds.

WB Suggested Anti-RIPK3 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

WB Suggested Anti-RIPK3 antibody Titration: 1 ug/ml, Sample Type: Human Jurkat.

WB Suggested Anti-RIPK3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.