SMAD5 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574013
| Article Name: |
SMAD5 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574013 |
| Supplier Catalog Number: |
orb574013 |
| Alternative Catalog Number: |
BYT-ORB574013-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SMAD5 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
DWFC, JV5-1, MADH5 |
| Rabbit polyclonal antibody to SMAD5 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
51kDa |
| NCBI: |
001001420 |
| UniProt: |
Q99717 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD |
| Target: |
SMAD5 |
![]()
|
WB Suggested Anti-SMAD5 Antibody, Titration: 2.5 ug/ml, Positive Control: HepG2 Whole Cell. |
