Aff1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574020
| Article Name: |
Aff1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574020 |
| Supplier Catalog Number: |
orb574020 |
| Alternative Catalog Number: |
BYT-ORB574020-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
R, Af, Af4, Rob, Mllt, Mllt2h, AW319193, 9630032B01Rik |
| Rabbit polyclonal antibody to Aff1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
132kDa |
| NCBI: |
598680 |
| UniProt: |
O88573 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG |
| Target: |
Aff1 |
![]()
|
WB Suggested Anti-Aff1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Kidney. |
