Wnt2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574058
| Article Name: |
Wnt2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574058 |
| Supplier Catalog Number: |
orb574058 |
| Alternative Catalog Number: |
BYT-ORB574058-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
M, m-, Int, Irp, Wnt, Mirp, Wnt-, Wnt-2, Wnt2a, Int1l1, 2610510E18Rik |
| Rabbit polyclonal antibody to Wnt2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
40kDa |
| NCBI: |
076142 |
| UniProt: |
P21552 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: RKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAG |
| Target: |
Wnt2 |
![]()
|
Antibody dilution: 1.0 ug/ml, Sample Type: Mouse Stomach. |
