ZNF280B Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574096
| Article Name: |
ZNF280B Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574096 |
| Supplier Catalog Number: |
orb574096 |
| Alternative Catalog Number: |
BYT-ORB574096-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Conjugation: |
Unconjugated |
| Alternative Names: |
SUHW2, ZNF279, ZNF632, 5OY11.1, D87009.C22.3 |
| Rabbit polyclonal antibody to ZNF280B |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
61kDa |
| NCBI: |
542942 |
| UniProt: |
Q86YH2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: EEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKP |
| Target: |
ZNF280B |
![]()
|
WB Suggested Anti-ZNF280B Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell. |
