EPAS1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574102
Article Name: EPAS1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574102
Supplier Catalog Number: orb574102
Alternative Catalog Number: BYT-ORB574102-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPAS1
Conjugation: Unconjugated
Alternative Names: HLF, MOP2, ECYT4, HIF2A, PASD2, bHLHe73
Rabbit polyclonal antibody to EPAS1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 90kDa
NCBI: 001421
UniProt: Q99814
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
Target: EPAS1
WB Suggested Anti-EPAS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.