Esrra Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574108
| Article Name: |
Esrra Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574108 |
| Supplier Catalog Number: |
orb574108 |
| Alternative Catalog Number: |
BYT-ORB574108-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Er, Es, Nr3, Err1, Nr3b1, Estrra, ERRalpha |
| Rabbit polyclonal antibody to Esrra |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
45kDa |
| NCBI: |
031979 |
| UniProt: |
O08580 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL |
| Target: |
Esrra |
![]()
|
WB Suggested Anti-Esrra Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse liver. |
