ID3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574145
| Article Name: |
ID3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574145 |
| Supplier Catalog Number: |
orb574145 |
| Alternative Catalog Number: |
BYT-ORB574145-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ID3 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HEIR-1, bHLHb25 |
| Rabbit polyclonal antibody to ID3 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
13kDa |
| NCBI: |
002158 |
| UniProt: |
Q02535 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSR |
| Target: |
ID3 |
![]()
|
WB Suggested Anti-ID3 Antibody Titration: 1.25 ug/ml, Positive Control: Transfected 293T. |
