ATOH1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574162
- Images (9)
| Article Name: | ATOH1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB574162 |
| Supplier Catalog Number: | orb574162 |
| Alternative Catalog Number: | BYT-ORB574162-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human ATOH1 |
| Conjugation: | Unconjugated |
| Alternative Names: | ATH1, HATH1, MATH-1, bHLHa14 |
| Rabbit polyclonal antibody to ATOH1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 38 kDa |
| NCBI: | 005163 |
| UniProt: | Q92858 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS |
| Target: | ATOH1 |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Placenta, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml. Peptide Concentration: 5 ug/ml. Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%. |
|
|
Immunohistochemistry with Liver cell lysate tissue. |
|
|
Immunohistochemistry with Spleen cell lysate tissue. |
|
|
Immunohistochemistry with Spleen cell lysate tissue. |
|
|
mouse cochlea |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
|
|
WB Suggested Anti-ATOH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta. |
Product Guarantee and Expert Support
