PSMD6 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574184
Article Name: PSMD6 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574184
Supplier Catalog Number: orb574184
Alternative Catalog Number: BYT-ORB574184-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD6
Conjugation: Unconjugated
Alternative Names: S10, Rpn7, p42A, p44S10, SGA-113M
Rabbit polyclonal antibody to PSMD6
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 45kDa
NCBI: 055629
UniProt: Q15008
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMA
Target: PSMD6
WB Suggested Anti-PSMD6 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.