LHX3 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574207
Article Name: LHX3 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574207
Supplier Catalog Number: orb574207
Alternative Catalog Number: BYT-ORB574207-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LHX3
Conjugation: Unconjugated
Alternative Names: LIM3, CPHD3, M2-LHX3
Rabbit polyclonal antibody to LHX3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 44kDa
NCBI: 055379
UniProt: Q5TB40
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Target: LHX3
WB Suggested Anti-LHX3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.