GRIP1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574236
Article Name: GRIP1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574236
Supplier Catalog Number: orb574236
Alternative Catalog Number: BYT-ORB574236-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIP1
Conjugation: Unconjugated
Alternative Names: GRIP, FRASRS3
Rabbit polyclonal antibody to GRIP1
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 117kDa
NCBI: 290559
UniProt: Q9Y3R0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKG
Target: GRIP1
WB Suggested Anti-GRIP1 Antibody Titration: 1.25 ug/ml, Positive Control: Human Muscle.