UHRF1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574283
Article Name: UHRF1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574283
Supplier Catalog Number: orb574283
Alternative Catalog Number: BYT-ORB574283-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UHRF1
Conjugation: Unconjugated
Alternative Names: Np95, hNP95, ICBP90, RNF106, TDRD22, hUHRF1, huNp95
Rabbit polyclonal antibody to UHRF1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 90kDa
UniProt: Q96T88
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQ
Target: UHRF1
Sample Type: HepG2 Whole cell lysates, Antibody dilution: 1.0 ug/ml.