CNOT7 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574288
Article Name: CNOT7 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574288
Supplier Catalog Number: orb574288
Alternative Catalog Number: BYT-ORB574288-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT7
Conjugation: Unconjugated
Alternative Names: CAF1, CAF-1, Caf1a, hCAF-1
Rabbit polyclonal antibody to CNOT7
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 33kDa
NCBI: 037486
UniProt: Q9UIV1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG
Target: CNOT7
WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.