Mnx1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB574297
| Article Name: |
Mnx1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB574297 |
| Supplier Catalog Number: |
orb574297 |
| Alternative Catalog Number: |
BYT-ORB574297-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Mnx1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
MN, HB9, Hlxb, MNR2, Hlxb9 |
| Rabbit polyclonal antibody to Mnx1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
41kDa |
| NCBI: |
064328 |
| UniProt: |
A2RSX2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: QQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK |
| Target: |
Mnx1 |
![]()
|
WB Suggested Anti-Mnx1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Testis. |
