MAFB Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: MAFB Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574783
• Supplier Catalog Number: orb574783
• Alternative Catalog Number: BYT-ORB574783-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAFB
• Conjugation: Unconjugated
• Alternative Names: KRML, MCTO, DURS3

Product Description

Rabbit polyclonal antibody to MAFB

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 36 kDa
• NCBI: 005452
• UniProt: Q9Y5Q3
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMAS
• Target: MAFB

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein may be phosphorylated and/or crosslinked to SUMO at two positions.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Mouse Spleen (M-SP), Negative control (-): Mouse Small Intestine (M-IN), Antibody concentration: 2 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Human Spleen

WB Suggested Anti-MAFB Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.