PARP16 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574809
Article Name: PARP16 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574809
Supplier Catalog Number: orb574809
Alternative Catalog Number: BYT-ORB574809-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PARP16
Conjugation: Unconjugated
Alternative Names: ARTD15, pART15, C15orf30
Rabbit polyclonal antibody to PARP16
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 36 kDa
NCBI: 060321
UniProt: Q8N5Y8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL
Target: PARP16
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. PARP16 is supported by BioGPS gene expression data to be expressed in HEK293T.
Positive control (+): Human Ovary (OV), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.
Rabbit Anti-PARP16 Antibody, Catalog Number: orb574809, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. PARP16 is supported by BioGPS gene expression data to be expressed in HEK293T.