ZFR Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: ZFR Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB575135
• Supplier Catalog Number: orb575135
• Alternative Catalog Number: BYT-ORB575135-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFR
• Conjugation: Unconjugated
• Alternative Names: ZFR1, SPG71

Product Description

Rabbit polyclonal antibody to ZFR

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 117kDa
• NCBI: 057191
• UniProt: Q96KR1
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN
• Target: ZFR

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-ZFR Antibody, Catalog Number: orb575135, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and nuclear in pinelocytes & intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-ZFR Antibody, Catalog Number: orb575135, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-ZFR Antibody, Paraffin Embedded Tissue: Human bronchiole epithelium, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ZFR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, ZFR is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.