Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
Target:
SLC26A4
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 86 kDa is present as well as a second isoform around 39 kDa.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-SLC26A4 antibody (orb578191).