SLC26A4 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SLC26A4 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB578191
• Supplier Catalog Number: orb578191
• Alternative Catalog Number: BYT-ORB578191-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC26A4
• Conjugation: Unconjugated
• Alternative Names: EVA, PDS, DFNB4, TDH2B

Product Description

Rabbit polyclonal antibody to SLC26A4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 86 kDa
• NCBI: 000432
• UniProt: O43511
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
• Target: SLC26A4

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 86 kDa is present as well as a second isoform around 39 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-SLC26A4 antibody (orb578191).

WB Suggested Anti-SLC26A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.