SLC38A3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SLC38A3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB578426
• Supplier Catalog Number: orb578426
• Alternative Catalog Number: BYT-ORB578426-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3
• Conjugation: Unconjugated
• Alternative Names: G17, SN1, NAT1, SNAT3

Product Description

Rabbit polyclonal antibody to SLC38A3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 56 kDa
• NCBI: 006832
• UniProt: Q99624
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
• Target: SLC38A3

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.

Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.

Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Submucosal Plexus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLC38A3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2.