CHAC1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: CHAC1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB578544
• Supplier Catalog Number: orb578544
• Alternative Catalog Number: BYT-ORB578544-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHAC1
• Conjugation: Unconjugated
• Alternative Names: MGC4504

Product Description

Rabbit polyclonal antibody to CHAC1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 24 kDa
• NCBI: 077016
• UniProt: Q9BUX1
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
• Target: CHAC1

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in 24 kDa canonical isoform as well as 29 kDa isoform and a 19 kDa isoform. Higher molecular weight bands may indicate enzymatic intermediates involving the full length protein.

Sample Tissue: Human Du145 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human H69 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/ml.

WB Suggested Anti-CHAC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. CHAC1 is supported by BioGPS gene expression data to be expressed in 721_B.