HDAC9 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: HDAC9 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB578600
• Supplier Catalog Number: orb578600
• Alternative Catalog Number: BYT-ORB578600-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9
• Conjugation: Unconjugated
• Alternative Names: HD7, HD9, HD7b, HDAC, HDRP, MITR, HDAC7, HDAC7B, HDAC9B, HDAC9FL

Product Description

Rabbit polyclonal antibody to HDAC9

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 65 kDa
• NCBI: 055522
• UniProt: Q9UKV0
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
• Target: HDAC9

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The c-terminal peptide used to generate this antibody is not present in the full length canonical isoform, but is present in several HDAC9 isoforms below 654 amino acids. In these samples, isoform 8 of 65 kDa is recognized as well as possibly isoform 11 at 57 kDa.

Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region (orb578600) and HCT116 Cells.

Sample Tissue: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Human kidney

Rabbit Anti-HDAC9 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HDAC9 Antibody Titration: 1.25 ug/ml, Positive Control: A172 cell lysate. HDAC9 is supported by BioGPS gene expression data to be expressed in A172.