GADD45B Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: GADD45B Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB580375
• Supplier Catalog Number: orb580375
• Alternative Catalog Number: BYT-ORB580375-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GADD45B
• Conjugation: Unconjugated
• Alternative Names: MYD118, GADD45BETA

Product Description

Rabbit polyclonal antibody to GADD45B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 18kDa
• NCBI: 056490
• UniProt: O75293
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
• Target: GADD45B

Images

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

Sample Type: Fetal Lung lysates, Antibody dilution: 3.0 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB, brown), nuclei (hematoxylin, blue), Gene Name: GADD45B.

Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB, brown), nuclei (hematoxylin, blue), Gene Name: GADD45B.

Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB, brown), nuclei (hematoxylin, blue), Gene Name: GADD45B.

WB Suggested Anti-GADD45B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.