PDIA6 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: PDIA6 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB581570
• Supplier Catalog Number: orb581570
• Alternative Catalog Number: BYT-ORB581570-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, IP, WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDIA6
• Conjugation: Unconjugated
• Alternative Names: P5, ERP5, TXNDC7

Product Description

Rabbit polyclonal antibody to PDIA6

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 48kDa
• NCBI: 005733
• UniProt: Q922R8
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
• Target: PDIA6

Images

Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA6, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA6.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type:Mouse Brain lysate.

WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.