CAMKK2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: CAMKK2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB581980
• Supplier Catalog Number: orb581980
• Alternative Catalog Number: BYT-ORB581980-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2
• Conjugation: Unconjugated
• Alternative Names: CAMKK, CAMKKB

Product Description

Rabbit polyclonal antibody to CAMKK2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 55kDa
• NCBI: 705720
• UniProt: Q96RR4
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
• Target: CAMKK2

Images

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2.

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B.