CHMP4B Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: CHMP4B Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB582037
• Supplier Catalog Number: orb582037
• Alternative Catalog Number: BYT-ORB582037-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B
• Conjugation: Unconjugated
• Alternative Names: SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT31, Vps32-2, C20orf178, dJ553F4.4

Product Description

Rabbit polyclonal antibody to CHMP4B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 25kDa
• NCBI: 789782
• UniProt: Q9H444
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP
• Target: CHMP4B

Images

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-CHMP4B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CHMP4B Antibody Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.