HSPA1L Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB582161
Article Name: HSPA1L Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB582161
Supplier Catalog Number: orb582161
Alternative Catalog Number: BYT-ORB582161-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
Conjugation: Unconjugated
Alternative Names: HSP70T, hum70t, HSP70-1L, HSP70-HOM
Rabbit polyclonal antibody to HSPA1L
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 70kDa
NCBI: 005518
UniProt: P34931
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Target: HSPA1L
Sample Type: 1. Lamprey CNS (20 ug), 2. Rat Brain Lysate (20 ug), Primary dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary dilution: 1:4000.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human MDA-MB-435s, Antibody dilution: 1.0 ug/ml.
HSPA1L was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582161 with 1:200 dilution. Western blot was performed using orb582161 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: HSPA1L IP with orb582161 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Rabbit Anti-HSPA1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-HSPA1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.