Arsg antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB582642
Article Name: Arsg antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB582642
Supplier Catalog Number: orb582642
Alternative Catalog Number: BYT-ORB582642-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Arsg
Conjugation: Unconjugated
Alternative Names: RGD1306571
Rabbit polyclonal antibody to Arsg
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 57kDa
NCBI: 001041342
UniProt: Q32KJ9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDN
Target: Arsg