Arsg antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB582643
Article Name: |
Arsg antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB582643 |
Supplier Catalog Number: |
orb582643 |
Alternative Catalog Number: |
BYT-ORB582643-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Conjugation: |
Unconjugated |
Alternative Names: |
ASG, AI846872, 6330406P08Rik |
Rabbit polyclonal antibody to Arsg |
Clonality: |
Polyclonal |
Concentration: |
0.5 mg/ml |
Molecular Weight: |
58kDa |
NCBI: |
082986 |
UniProt: |
Q3TYD4 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: GRDVSEVLFGKSQMGHRVLFHPNSGAAGEYGALQTVRLNHYKAFYITGGA |
Target: |
Arsg |