ATP6V1A antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB583104
| Article Name: |
ATP6V1A antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB583104 |
| Supplier Catalog Number: |
orb583104 |
| Alternative Catalog Number: |
BYT-ORB583104-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1A |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HO68, VA68, VPP2, Vma1, DEE93, ARCL2D, ATP6A1, IECEE3, ATP6V1A1 |
| Rabbit polyclonal antibody to ATP6V1A |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
68kDa |
| NCBI: |
001681 |
| UniProt: |
P38606 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR |
| Target: |
ATP6V1A |
