Atp6v1b1 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB583105
| Article Name: |
Atp6v1b1 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB583105 |
| Supplier Catalog Number: |
orb583105 |
| Alternative Catalog Number: |
BYT-ORB583105-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Atp6v1b1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
V, Vp, Atp6, Vpp3, Vpp-3, Atp6b1, AW208839, D630003L15, D630030L16Rik, D630039P21Rik |
| Rabbit polyclonal antibody to Atp6v1b1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
56kDa |
| NCBI: |
598918 |
| UniProt: |
Q91YH6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: PRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTLPDGTQRSGQVLEVAGT |
| Target: |
Atp6v1b1 |
