RAB1A Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: RAB1A Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB583215
• Supplier Catalog Number: orb583215
• Alternative Catalog Number: BYT-ORB583215-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB1A
• Conjugation: Unconjugated
• Alternative Names: RAB1, YPT1

Product Description

Rabbit polyclonal antibody to RAB1A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 23kDa
• NCBI: 004152
• UniProt: P62820
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
• Target: RAB1A

Images

Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-Rabbit, Secondary dilution: 1:40000.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 293T Whole cell lysates, Antibody dilution: 0.2 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. RAB1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Rabbit Anti-RAB1A Antibody, Catalog Number: orb583215, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic in excellent staining, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.