CRBN Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: CRBN Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB583354
• Supplier Catalog Number: orb583354
• Alternative Catalog Number: BYT-ORB583354-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN
• Conjugation: Unconjugated
• Alternative Names: MRT2, MRT2A

Product Description

Rabbit polyclonal antibody to CRBN

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 50 kDa
• NCBI: 057386
• UniProt: Q96SW2
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
• Target: CRBN

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HCT15, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Sample Type: RPMI-8226 Whole cell lysates, Antibody dilution: 0.5 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-CRBN Antibody Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.