C7orf57 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB586943
Article Name: C7orf57 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB586943
Supplier Catalog Number: orb586943
Alternative Catalog Number: BYT-ORB586943-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C7orf57
Conjugation: Unconjugated
Rabbit polyclonal antibody to C7orf57
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 32kDa
NCBI: 001093629
UniProt: Q8NEG2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EKAVDAPPASQIPGLSNLGDSHSENLPGTRRYWIKETDSEYVKLAKQGGR
Target: C7orf57