PARPBP antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB586947
Article Name: PARPBP antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB586947
Supplier Catalog Number: orb586947
Alternative Catalog Number: BYT-ORB586947-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PARPBP
Conjugation: Unconjugated
Alternative Names: AROM, PARI, C12orf48
Rabbit polyclonal antibody to PARPBP
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 32kDa
UniProt: Q9NWS1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: NEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKCTAKDKLISGQAKLTQ
Target: PARPBP