ARMH1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587285
Article Name: ARMH1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587285
Supplier Catalog Number: orb587285
Alternative Catalog Number: BYT-ORB587285-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C1orf228
Conjugation: Unconjugated
Alternative Names: p40, C1orf228, NCRNA00082
Rabbit polyclonal antibody to ARMH1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 48kDa
NCBI: 001139108
UniProt: Q6PIY5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSG
Target: ARMH1