Human ACE2 protein

Product Overview

• Article Name: Human ACE2 protein
• Biozol Catalog Number: BYT-ORB594921
• Supplier Catalog Number: orb594921
• Alternative Catalog Number: BYT-ORB594921-1,BYT-ORB594921-10,BYT-ORB594921-50,BYT-ORB594921-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

This Human ACE2 protein spans the amino acid sequence from region 18-740aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 84.63 kDa
• UniProt: Q9BYF1
• Buffer: 0.2 µm filtered 20 mM Tris, 300 mM NaCl, 1 mM ZnCl2, 10% Glycerol, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Liquid
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Loaded 2019-nCoV S Protein RBD-mFc on AMC Biosensor, can bind Human ACE-2-His with an affinity constant of 2.06 nM as determined in BLI assay. Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.