Virus ply protein

Product Overview

• Article Name: Virus ply protein
• Biozol Catalog Number: BYT-ORB595045
• Supplier Catalog Number: orb595045
• Alternative Catalog Number: BYT-ORB595045-1,BYT-ORB595045-100,BYT-ORB595045-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Thiol-activated cytolysin

Product Description

This Virus ply protein spans the amino acid sequence from region 2-471aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 56.8 kDa
• UniProt: P0C2J9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKS

Application Notes

• Application Notes: Biological Origin: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) ply.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) ply.