Mouse Tmprss6 protein
Catalog Number:
BYT-ORB595135
- Images (3)
| Article Name: | Mouse Tmprss6 protein |
| Biozol Catalog Number: | BYT-ORB595135 |
| Supplier Catalog Number: | orb595135 |
| Alternative Catalog Number: | BYT-ORB595135-1,BYT-ORB595135-100,BYT-ORB595135-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Matriptase-2 |
| This Mouse Tmprss6 protein spans the amino acid sequence from region 81-811aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 86.1 kDa |
| UniProt: | Q9DBI0 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | KAEVTVSQVYSGSLRVLNRHFSQDLGRRESIAFRSESAKAQKMLQELVASTRLGTYYNSSSVYSFGEGPLTCFFWFILDIPEYQRLTLSPEVVRELLVDELLSNSSTLASYKTEYEVDPEGLVILEASVNDIVVLNSTLGCYRYSYVNPGQVLPLKGPDQQTTSCLWHLQGPEDLMIKVRLEWTRVDCRDRVAMYDAAGPLEKRLITSVYGCSRQEPVMEVLASGSVMAVVWKKGMHSYYDPFLLSVKSVAFQDC |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular Domain |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Tmprss6. |
|
|
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Tmprss6. |
Product Guarantee and Expert Support
