Human PPP2R2C protein

Product Overview

• Article Name: Human PPP2R2C protein
• Biozol Catalog Number: BYT-ORB595147
• Supplier Catalog Number: orb595147
• Alternative Catalog Number: BYT-ORB595147-1,BYT-ORB595147-100,BYT-ORB595147-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: IMYPNO1 (PP2A subunit B isoform B55-gamma) (PP2A subunit B isoform PR55-gamma) (PP2A subunit B isoform R2-gamma) (PP2A subunit B isoform gamma)

Product Description

This Human PPP2R2C protein spans the amino acid sequence from region 1-447aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 55.5 kDa
• UniProt: Q9Y2T4
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PPP2R2C.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PPP2R2C.