Human CCR4 protein

Product Overview

• Article Name: Human CCR4 protein
• Biozol Catalog Number: BYT-ORB595152
• Supplier Catalog Number: orb595152
• Alternative Catalog Number: BYT-ORB595152-100,BYT-ORB595152-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: K5-5 CD_antigen, CD194

Product Description

This Human CCR4 protein spans the amino acid sequence from region 1-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.2 kDa
• UniProt: P51679
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFW

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR4 at 5 µg/mL can bind Anti-CCR4 recombinant antibody, the EC50 is 7.818-21.25 ng/mL. Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CCR4 at 5 µg/ml can bind Anti-CCR4 recombinant antibody. The EC50 is 2.803-3.369 ng/mL.

Human CCR4 Full Length Protein captured on CM5 chip can bind Human CCR4 Monoclonal Antibody with an affinity constant of 3.16 nM as detected by SPR Assay (Biacore T200).

Human CCR4 Monoclonal Antibody captured on Protein A Chip can bind Human CCR4 Full Length Protein with an affinity constant of 1.71 nM as detected by MetaSPR Assay (in presence of FOS-12) (WeSPRTM200).