Human ARID1A protein

Catalog Number: BYT-ORB603918
Article Name: Human ARID1A protein
Biozol Catalog Number: BYT-ORB603918
Supplier Catalog Number: orb603918
Alternative Catalog Number: BYT-ORB603918-1,BYT-ORB603918-100,BYT-ORB603918-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: B120 BRG1-associated factor 250 Short name, BAF250 BRG1-associated factor 250a Short name, BAF250A Osa homolog 1 Short name, hOSA1 SWI-like protein SWI/SNF complex protein p270 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 hELD C1orf4, OSA1, SMARCF1
This Human ARID1A protein spans the amino acid sequence from region 1976-2231aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 33.4 kDa
UniProt: O14497
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDM
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ARID1A.