Human CBR1 protein

Product Overview

• Article Name: Human CBR1 protein
• Biozol Catalog Number: BYT-ORB603957
• Supplier Catalog Number: orb603957
• Alternative Catalog Number: BYT-ORB603957-1,BYT-ORB603957-100,BYT-ORB603957-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 15-hydroxyprostaglandin dehydrogenase [NADP(+)] (EC, 1.1.1.197)NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductaseProstaglandin-E(2) 9-reductase (EC, 1.1.1.189)Short chain dehydrogenase/reductase family 21C member 1

Product Description

This Human CBR1 protein spans the amino acid sequence from region 2-277aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 34.2 kDa
• UniProt: P16152
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLAL

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CBR1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CBR1.