Human CD206 protein

Catalog Number: BYT-ORB604255
Article Name: Human CD206 protein
Biozol Catalog Number: BYT-ORB604255
Supplier Catalog Number: orb604255
Alternative Catalog Number: BYT-ORB604255-1,BYT-ORB604255-100,BYT-ORB604255-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C-type lectin domain family 13 member D C-type lectin domain family 13 member D-like Human mannose receptor Short name, hMR Macrophage mannose receptor 1-like protein 1 CD_antigen, CD206 CLEC13D, CLEC13DL, MRC1L1
This Human CD206 protein spans the amino acid sequence from region 655-1213aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 69.9 kDa
UniProt: P22897
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MRC1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MRC1.