Rat S100a4 protein
Catalog Number:
BYT-ORB604364
- Images (3)
| Article Name: | Rat S100a4 protein |
| Biozol Catalog Number: | BYT-ORB604364 |
| Supplier Catalog Number: | orb604364 |
| Alternative Catalog Number: | BYT-ORB604364-1,BYT-ORB604364-100,BYT-ORB604364-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Metastasin (Nerve growth factor-induced protein 42A) (P9K) (Placental calcium-binding protein) (S100 calcium-binding protein A4) |
| This Rat S100a4 protein spans the amino acid sequence from region 2-101aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 18.6 kDa |
| UniProt: | P05942 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Rattus norvegicus (Rat) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK |
| Application Notes: | Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein |



