Rat CD106 protein
Catalog Number:
BYT-ORB604447
- Images (3)
| Article Name: | Rat CD106 protein |
| Biozol Catalog Number: | BYT-ORB604447 |
| Supplier Catalog Number: | orb604447 |
| Alternative Catalog Number: | BYT-ORB604447-20,BYT-ORB604447-100,BYT-ORB604447-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | CD106 |
| This Rat CD106 protein spans the amino acid sequence from region 31-697aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 77.4 kDa |
| UniProt: | P29534 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Rattus norvegicus (Rat) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PEYKTLAQIGDSMLLTCSTTGCESPSFSWRTQIDSPLNGKVKTEGAKSVLTMDPVSFENEHSYLCTATCNSGKLERGIQVDIYSFPKDPEIQFSGPLEVGKPVMVKCLAPDVYPIDRLEIELFKGDRLMKKQDFVDEMAKKSLETKSLEVIFTPVIEDIEKALVCRAKLYIDQTDSIPKERETVRELQVYTSPKNTEISVHPSTRLHEGAAVTMTCASEGLPAPEIFWSKKLDNGVLQLLSGNATLTLIAMRMED |
| Application Notes: | Biological Origin: Rattus norvegicus (Rat). Application Notes: Partial |



