E. coli fliC protein

Product Overview

• Article Name: E. coli fliC protein
• Biozol Catalog Number: BYT-ORB604505
• Supplier Catalog Number: orb604505
• Alternative Catalog Number: BYT-ORB604505-20,BYT-ORB604505-100,BYT-ORB604505-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: fliC, flaF, hag, b1923, JW1908Flagellin

Product Description

This E. coli fliC protein spans the amino acid sequence from region 2-498aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 51.2 kDa
• UniProt: P04949
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli (strain K12)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTV

Application Notes

• Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fliC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fliC.