Virus Lassa virus Nucleoprotein(N) protein

Product Overview

• Article Name: Virus Lassa virus Nucleoprotein(N) protein
• Biozol Catalog Number: BYT-ORB604564
• Supplier Catalog Number: orb604564
• Alternative Catalog Number: BYT-ORB604564-20,BYT-ORB604564-100,BYT-ORB604564-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Nucleocapsid protein Protein N

Product Description

This Virus Lassa virus Nucleoprotein(N) protein spans the amino acid sequence from region 1-569aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 63 kDa
• UniProt: P13699
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYNFSLGAAVKAG

Application Notes

• Application Notes: Biological Origin: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV). Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) N.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) N.